PDB entry 1boy

View 1boy on RCSB PDB site
Description: extracellular region of human tissue factor
Class: class 2 cytokine receptor
Keywords: initiator of blood coagulation in vertebrates, cofactor for factor viia, class 2 cytokine receptor, glycoprotein, blood coagulation
Deposited on 1996-01-11, released 1996-06-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human tissue factor
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN TISSUE FACTOR CDNA CODON
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1boya1, d1boya2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1boyA (A:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boyA (A:)
    ttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltde
    ivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtk
    vnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkg
    enycfsvqavipsrtvnrkstdspvecmgqe