PDB entry 1boy

View 1boy on RCSB PDB site
Description: extracellular region of human tissue factor
Deposited on 1996-01-11, released 1996-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.203
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1boy_ (-)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boy_ (-)
    ttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltde
    ivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtk
    vnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkg
    enycfsvqavipsrtvnrkstdspvecmgqe