PDB entry 1bog

View 1bog on RCSB PDB site
Description: anti-p24 (hiv-1) fab fragment cb41 complexed with an epitope-homologous peptide
Deposited on 1998-08-04, released 1999-03-23
The last revision prior to the SCOP 1.65 freeze date was dated 1999-03-23, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bogA (A:)
    dikmtqspssmytslgervtitckasqdinsfltwflqkpgkspktliyranrlmigvps
    rfsgsgsgqtysltissleyedmgiyyclqyddfpltfgagtkldlkradaaptvsifpp
    sseqltsgtasvvcflnnfypkeinvkwkidgserqngvldswteqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bogB (B:)
    qdqlqqsgaelvrpgasvklsckalgyiftdyeihwvkqtpvhglewiggihpgssgtay
    nqkfkgkatltadkssttafmelssltsedsavyyctrkdywgqgtlvtvsaakttapsv
    yplvpvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsglytlsssv
    tvtsntwpsqtitcnvahpasstkvdkkieprv