PDB entry 1bof

View 1bof on RCSB PDB site
Description: gi-alpha-1 bound to gdp and magnesium
Deposited on 1998-08-04, released 1999-01-06
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bof_ (-)
    kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckqy
    kavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvikr
    lwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethf
    tfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
    fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaayiqcqfed
    lnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bof_ (-)
    kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckqy
    kavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvikr
    lwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethf
    tfkdlhfkmfdvggvtaiifcvalsdydlmnrmhesmklfdsicnnkwftdtsiilflnk
    kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
    nvqfvfdavtdviiknnlkdcglf