PDB entry 1bnp

View 1bnp on RCSB PDB site
Description: nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Deposited on 1996-04-25, released 1996-12-07
The last revision prior to the SCOP 1.65 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: NMR55
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1bnp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnp_ (-)
  mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
  klpgvgtkiaekideflatgklrklek