PDB entry 1bno

View 1bno on RCSB PDB site
Description: nmr solution structure of the n-terminal domain of DNA polymerase beta, minimized average structure
Class: nucleotidyltransferase (DNA-binding)
Keywords: n-terminal domain, DNA polymerase beta, single-stranded DNA-binding, nucleotidyltransferase
Deposited on 1996-04-25, released 1996-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA polymerase beta
  Species: Rattus norvegicus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06766 (1-86)
  Domains in SCOP 1.73: d1bnoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bnoA (A:)
  mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
  klpgvgtkiaekideflatgklrklek