PDB entry 1bno

View 1bno on RCSB PDB site
Description: nmr solution structure of the n-terminal domain of dna polymerase beta, minimized average structure
Deposited on 1996-04-25, released 1996-12-07
The last revision prior to the SCOP 1.61 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bno__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bno_ (-)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklek