PDB entry 1bmd

View 1bmd on RCSB PDB site
Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus
Class: oxidoreductase(choh(d)-nad+(a))
Keywords: oxidoreductase(choh(d)-nad+(a))
Deposited on 1992-11-10, released 1994-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • conflict (74)
    Domains in SCOPe 2.07: d1bmda1, d1bmda2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • conflict (74)
    Domains in SCOPe 2.07: d1bmdb1, d1bmdb2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmdA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bmdB (B:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhsstmfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli