PDB entry 1bm1

View 1bm1 on RCSB PDB site
Description: crystal structure of bacteriorhodopsin in the light-adapted state
Deposited on 1998-07-28, released 1999-04-27
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-20, with a file datestamp of 1999-09-19.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.26
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bm1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bm1_ (-)
    rpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygl
    tmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglvga
    ltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsayp
    vvwligsegagivplnietllfmvldvsakvgfglillrsr