PDB entry 1blx

View 1blx on RCSB PDB site
Description: p19ink4d/cdk6 complex
Class: complex (inhibitor protein/kinase)
Keywords: inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase)
Deposited on 1998-07-21, released 1999-06-01
The last revision prior to the SCOP 1.75 freeze date was dated 1999-08-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1blxa_
  • Chain 'B':
    Compound: p19ink4d
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1blxb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blxA (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qdlerckenldshlppsqntselnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blxA (A:)
    glcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevav
    lrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikd
    mmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlw
    yrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwp
    rdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdle
    rcken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1blxB (B:)
    mlleevcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalel
    lkqgaspnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghs
    svvsflapesdlhhrdasgltplelarqrgaqnlmdilqghmmipm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blxB (B:)
    vcvgdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgspavalellkqga
    spnvqdasgtspvhdaartgfldtlkvlvehgadvnaldstgslpihlaireghssvvsf
    lapesdlhhrdasgltplelarqrgaqnlmdilqghmmip