PDB entry 1blw

View 1blw on RCSB PDB site
Description: efficiency of signalling via cytokine receptors depends critically on receptor orientation.
Class: hormone/hormone receptor
Keywords: erythropoietin, erythropoietin receptor, epo, cytokine, cytokine class I receptor
Deposited on 1998-07-21, released 1999-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 1999-08-09, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (erythropoietin receptor)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered (210)
      • conflict (6-9)
  • Chain 'B':
    Compound: protein (erythropoietin receptor)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19235
      • engineered (210)
      • conflict (6-9)
  • Chain 'C':
    Compound: protein (erythropoietin)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01588
      • engineered (23)
      • engineered (37)
    Domains in SCOPe 2.08: d1blwc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1blwC (C:)
    apprlicdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqa
    vevwqglallseavlrgqallvnssqpweplqlhvdkavsglrslttllralgaqkeais
    ppdaasaaplrtitadtfrklfrvysnflrgklklytgeacrtgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blwC (C:)
    licdsrvlerylleakeaekittgcaehcslnekitvpdtkvnfyawkrmevgqqavevw
    qglallseavlrgqallvnssqpweplqlhvdkavsglrslttllralgatitadtfrkl
    frvysnflrgklklytgeacr