PDB entry 1bls

View 1bls on RCSB PDB site
Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog
Class: hydrolase (acting in cyclic amides)
Keywords: hydrolase (acting in cyclic amides)
Deposited on 1993-12-17, released 1995-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1blsa_
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1blsb_
  • Heterogens: IPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1blsA (A:)
    tpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
    envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvae
    vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blsA (A:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1blsB (B:)
    tpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlf
    elgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplq
    vpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlk
    plkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmap
    envadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvae
    vnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1blsB (B:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal