PDB entry 1blj

View 1blj on RCSB PDB site
Description: nmr ensemble of blk sh2 domain, 20 structures
Deposited on 1996-03-26, released 1997-03-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1blj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1blj_ (-)
    gsvapvetlevekwffrtisrkdaerqllapmnkagsfliresesnkgafslsvkdittq
    gevvkhykirsldnggyyispritfptlqalvqhyskkgdglcqkltlpcvnla