PDB entry 1bkn

View 1bkn on RCSB PDB site
Description: crystal structure of an n-terminal 40kd fragment of e. coli dna mismatch repair protein mutl
Deposited on 1998-07-09, released 1999-05-11
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bknA (A:)
    verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalarhatsk
    iaslddleaiislgfrgealasissvsrltltsrtaeqqeawqayaegrdmnvtvkpaah
    pvgttlevldlfyntparrkflrtektefnhideiirrialarfdvtinlshngkivrqy
    ravpeggqkerrlgaicgtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvn
    grmmrdrlinhairqacedklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvh
    dfiyqgvlsvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bknA (A:)
    verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalaiasldd
    leaiislgfrgealasissvsrltltsrtaeqqeawqayavtvkpaahpvgttlevldte
    ktefnhideiirrialarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqa
    laiewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadq
    qpafvlyleidphqvsrlvhdfiyqgvlsvlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bknB (B:)
    verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalarhatsk
    iaslddleaiislgfrgealasissvsrltltsrtaeqqeawqayaegrdmnvtvkpaah
    pvgttlevldlfyntparrkflrtektefnhideiirrialarfdvtinlshngkivrqy
    ravpeggqkerrlgaicgtafleqalaiewqhgdltlrgwvadpnhttpalaeiqycyvn
    grmmrdrlinhairqacedklgadqqpafvlyleidphqvdvnvhpakhevrfhqsrlvh
    dfiyqgvlsvlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bknB (B:)
    verpasvvkelvensldagatrididierggaklirirdngcgikkdelalalaeaiisl
    gfrgealasissvsrltltsrtaeqqeawqaymnvtvkpaahpvgttlevldllrtekte
    fnhideiirrialarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalai
    ewqhgdltlrgwvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpa
    fvlyleidphqvhqsrlvhdfiyqgvlsvlq