PDB entry 1bkl

View 1bkl on RCSB PDB site
Description: self-associated apo src sh2 domain
Deposited on 1997-05-02, released 1997-07-23
The last revision prior to the SCOP 1.61 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bkl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bkl_ (-)
eewyfgkitrreseslllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskefivtd