PDB entry 1bjm

View 1bjm on RCSB PDB site
Description: loc naks, a lambda 1 type light-chain dimer (bence-jones protein) crystallized in nakso4
Deposited on 1995-05-26, released 1995-12-07
The last revision prior to the SCOP 1.59 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.158
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjmA (A:)
    esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bjmB (B:)
    esvltqppsasgtpgqrvtiscsgsssnigensvtwyqhlsgtapklliyednsrasgvs
    drfsasksgtsaslaisglqpedetdyycaawddsldvavfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs