PDB entry 1bi8

View 1bi8 on RCSB PDB site
Description: mechanism of g1 cyclin dependent kinase inhibition from the structures cdk6-p19ink4d inhibitor complex
Deposited on 1998-06-22, released 1999-01-13
The last revision prior to the SCOP 1.59 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.255
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1bi8a_
  • Chain 'B':
    Domains in SCOP 1.59: d1bi8b_
  • Chain 'C':
    Domains in SCOP 1.59: d1bi8c_
  • Chain 'D':
    Domains in SCOP 1.59: d1bi8d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bi8A (A:)
    qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
    fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
    rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
    llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
    rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi8A (A:)
    qqyecvaeigegaygkvfkardlknggrfvalkrvrvqehpnvvrlfdvctvsrtkltlv
    fehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqnilvtssg
    qikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifaemfrrkp
    lfrgssdvdqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdll
    lkcltfnpakrisaysalshpyfq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bi8B (B:)
    vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
    spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
    laaesdlhrrdargltplelalqrgaqdlvdilqg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bi8C (C:)
    qqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhlet
    fehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqll
    rgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapev
    llqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdvalp
    rqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi8C (C:)
    qqyecvaeigegaygkvfkardlknggrfvalkrvrvqehpnvvrlfdvctvsrtkltlv
    fehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqnilvtssg
    qikladfglariysfqmaltsvvvtlwyrapevllqssyatpvdlwsvgcifaemfrrkp
    lfrgssdvdqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdll
    lkcltfnpakrisaysalshpyfq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bi8D (D:)
    vragdrlsgaaargdvqevrrllhrelvhpdalnrfgktalqvmmfgstaialellkqga
    spnvqdtsgtspvhdaartgfldtlkvlvehgadvnvpdgtgalpihlavqeghtavvsf
    laaesdlhrrdargltplelalqrgaqdlvdilqg