PDB entry 1bhg

View 1bhg on RCSB PDB site
Description: human beta-glucuronidase at 2.6 a resolution
Deposited on 1996-03-04, released 1997-09-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhgA (A:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
    qntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevr
    lldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfyt
    lpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganaf
    rtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhp
    avvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvicl
    nsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteey
    qkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafl
    lrerywkiane
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bhgB (B:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
    qntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevr
    lldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfyt
    lpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganaf
    rtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhp
    avvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvicl
    nsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteey
    qkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafl
    lrerywkiane