PDB entry 1bhg

View 1bhg on RCSB PDB site
Description: human beta-glucuronidase at 2.6 a resolution
Class: glycosidase
Keywords: lysosomal enzyme, acid hydrolase, glycosidase
Deposited on 1996-03-04, released 1997-09-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PLACENTAL GUS GENE CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhga1, d1bhga2, d1bhga3
  • Chain 'B':
    Compound: beta-glucuronidase
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN PLACENTAL GUS GENE CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bhgb1, d1bhgb2, d1bhgb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bhgA (A:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhgA (A:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
    qntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevr
    lldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfyt
    lpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganaf
    rtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhp
    avvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvicl
    nsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteey
    qkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafl
    lrerywkiane
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bhgB (B:)
    lglqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvp
    ssfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtl
    eheggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyf
    vqntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklev
    rlldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfy
    tlpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlgana
    frtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknh
    pavvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvic
    lnsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmftee
    yqkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaaf
    llrerywkianet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bhgB (B:)
    glqggmlypqespsreckeldglwsfradfsdnrrrgfeeqwyrrplwesgptvdmpvps
    sfndisqdwrlrhfvgwvwyerevilperwtqdlrtrvvlrigsahsyaivwvngvdtle
    heggylpfeadisnlvqvgplpsrlritiainntltpttlppgtiqyltdtskypkgyfv
    qntyfdffnyaglqrsvllyttpttyidditvttsveqdsglvnyqisvkgsnlfklevr
    lldaenkvvangtgtqgqlkvpgvslwwpylmherpaylyslevqltaqtslgpvsdfyt
    lpvgirtvavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganaf
    rtshypyaeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhp
    avvmwsvanepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdvicl
    nsyyswyhdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteey
    qkslleqyhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafl
    lrerywkiane