PDB entry 1bh4

View 1bh4 on RCSB PDB site
Description: circulin a from chassalia parviflora, nmr, 12 structures
Deposited on 1998-06-12, released 1999-06-15
The last revision prior to the SCOP 1.71 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1bh4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh4_ (-)
    cgescvwipcisaalgcscknkvcyrngip