PDB entry 1bh2

View 1bh2 on RCSB PDB site
Description: a326s mutant of an inhibitory alpha subunit
Deposited on 1998-06-12, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh2_ (-)
    revkllllgagesgkstivkqmkiiheagyseeeckqykavvysntiqsiiaiiramgrl
    kidfgdaaraddarqlfvlagaaeegfmtaelagvikrlwkdsgvqacfnrsreyqlnds
    aayylndldriaqpnyiptqqdvlrtrvkttgivethftfkdlhfkmfdvggqrserkkw
    ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
    dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcstdtkn
    vqfvfdavtdviikn