PDB entry 1bgy

View 1bgy on RCSB PDB site
Description: cytochrome bc1 complex from bovine
Class: electron transport
Keywords: electron transport, cytochrome, membrane protein
Deposited on 1998-06-02, released 1999-01-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.32
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgya1, d1bgya2
  • Chain 'B':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyb1, d1bgyb2
  • Chain 'C':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyc2, d1bgyc3
  • Chain 'D':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyd2, d1bgyd3
  • Chain 'E':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgye_
  • Chain 'F':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyf_
  • Chain 'G':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyg_
  • Chain 'H':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyh_
  • Chain 'I':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyi_
  • Chain 'J':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyj_
  • Chain 'K':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyk_
  • Chain 'M':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgym1, d1bgym2
  • Chain 'N':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyn1, d1bgyn2
  • Chain 'O':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyo2, d1bgyo3
  • Chain 'P':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyp2, d1bgyp3
  • Chain 'Q':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyq1, d1bgyq2
  • Chain 'R':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyr_
  • Chain 'S':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgys_
  • Chain 'T':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyt_
  • Chain 'U':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyu_
  • Chain 'V':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyv_
  • Chain 'W':
    Compound: cytochrome bc1 complex
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bgyw_
  • Heterogens: HEM, HEC, FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bgyB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyB (B:)
    pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
    ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
    qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
    sarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaalvae
    saaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsg
    lfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfld
    evgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bgyE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskie
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bgyF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyF (F:)
    avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
    aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bgyH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyH (H:)
    dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
    nslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1bgyI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyI (I:)
    krsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1bgyK (K:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyK (K:)
    rnwvptaqlwgavgavglvsat
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyM (M:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1bgyN (N:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyN (N:)
    pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
    ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
    qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
    sarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaalvae
    saaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsg
    lfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfld
    evgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyO (O:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyP (P:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyQ (Q:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1bgyR (R:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyR (R:)
    avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
    aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyS (S:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1bgyT (T:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyT (T:)
    dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
    nslk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1bgyU (U:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlkrsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyU (U:)
    krsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgyV (V:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1bgyW (W:)
    mltrflgpryrqlarnwvptaqlwgavgavglvsatdsrlildwvpyingkfkkdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bgyW (W:)
    rnwvptaqlwgavgavglvsat