PDB entry 1bgv

View 1bgv on RCSB PDB site
Description:
Deposited on 1998-06-01, released 1998-10-14
The last revision prior to the SCOP 1.65 freeze date was dated 2001-10-11, with a file datestamp of 2001-10-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1bgva1, d1bgva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bgvA (A:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw