PDB entry 1bg7

View 1bg7 on RCSB PDB site
Description: localized unfolding at the junction of three ferritin subunits. a mechanism for iron release?
Class: iron storage
Keywords: ferritin, iron storage
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Rana catesbeiana
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07229
      • engineered (82)
      • engineered (134)
    Domains in SCOP 1.73: d1bg7a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bg7A (A:)
    mdsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheer
    ehaeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlhkvgsd
    kvdphlcdfleteypeeqvksikqlgdyitnlkrlglpqngmgeylfdkhtmgess
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bg7A (A:)
    dsqvrqnfhrdceaainrmvnmelyasytylsmafyfdrddialhnvakffkeqsheere
    haeklmkdqnkrggrivlqdvqkperdewgntleamqaalqlektvnqalldlpeeqvks
    ikqlgdyitnlkrlglpqngmgeylfdkhtmge