PDB entry 1bg5

View 1bg5 on RCSB PDB site
Description: crystal structure of the ankyrin binding domain of alpha-na,k-atpase as a fusion protein with glutathione s-transferase
Deposited on 1998-06-05, released 1999-01-13
The last revision prior to the SCOP 1.63 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.193
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bg5_ (-)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgssyyqeaksskimes
    fknmvpqqalvnss