PDB entry 1bfv

View 1bfv on RCSB PDB site
Description: monoclonal antibody fragment fv4155 from e. coli
Deposited on 1997-05-27, released 1997-12-03
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.187
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1bfvh_
  • Chain 'L':
    Domains in SCOP 1.55: d1bfvl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfvH (H:)
    qvqlqesggglvnlggsmtlscvasgftfntyymswvrqtpektlelvaainsdgepiyy
    pdtlkgrvtisrdnakktlylqmsslnfedtalyycarlnyavygmdywgqgttvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfvL (L:)
    dieltqsppslpvslgdqvsiscrssqslvsnnrrnylhwylqkpgqspklviykvsnrf
    sgvpdrfsgsgsgtdftlkisrvaaedlglyfcsqsshvpltfgsgtkleikr