PDB entry 1bfs

View 1bfs on RCSB PDB site
Description: structure of nf-kb p50 homodimer bound to a kb site
Deposited on 1997-09-12, released 1998-01-28
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1bfs__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bfs_ (-)
  asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
  rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype