PDB entry 1bfo

View 1bfo on RCSB PDB site
Description: campath-1g igg2b rat monoclonal fab
Deposited on 1998-05-20, released 1999-03-16
The last revision prior to the SCOP 1.63 freeze date was dated 1999-03-16, with a file datestamp of 1999-03-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.192
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoA (A:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoB (B:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoC (C:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoD (D:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoE (E:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoF (F:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoG (G:)
    dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
    rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelkranaaptvsifpp
    steqlatggasvvclmnkfyprdisvkwkidgterngvlnsvtdqdsadstysmsstlsl
    tkadyqshnlytcqvvhktssspvvaknfnrnec
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfoH (H:)
    evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
    eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
    saqttapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqs
    glytltssvtsstwpsqtvtcnvahpasstkvdkkv