PDB entry 1bfn

View 1bfn on RCSB PDB site
Description: beta-amylase/beta-cyclodextrin complex
Deposited on 1998-05-22, released 1998-10-28
The last revision prior to the SCOP 1.57 freeze date was dated 1998-11-18, with a file datestamp of 1998-11-18.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.158
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bfn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bfn_ (-)
    nmllnyvpvyvmlplgvvnvdnvfedpdglkeqllqlraagvdgvmvdvwwgiielkgpk
    qydwrayrsllqlvqecgltlqaimsfhqcggnvgdivnipipqwvldigesnhdifytn
    rsgtrnkeyltvgvdnepifhgrtaieiysdymksfrenmsdflesgliidievglgpag
    elrypsypqsqgwefpgigefqcydkylkadfkaavaraghpewelpddagkyndvpest
    gffksngtyvtekgkffltwysnkllnhgdqildeankaflgckvklaikvsgihwwykv
    enhaaeltagyynlndrdgyrpiarmlsrhhailnftclemrdseqpsdaksgpqelvqq
    vlsggwredirvagenalprydataynqiilnarpqgvnnngppklsmfgvtylrlsddl
    lqksnfnifkkfvlkmhadqdycanpqkynhaitplkpsapkipievlleatkptlpfpw
    lpetdmkvdg