PDB entry 1bfj

View 1bfj on RCSB PDB site
Description: solution structure of the c-terminal sh2 domain of the p85alpha regulatory subunit of phosphoinositide 3-kinase, nmr, minimized average structure
Deposited on 1997-11-18, released 1998-02-25
The last revision prior to the SCOP 1.57 freeze date was dated 1998-02-25, with a file datestamp of 1998-02-25.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1bfj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bfj_ (-)
  edlphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvin
  ktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvyaqqrr