PDB entry 1bf9

View 1bf9 on RCSB PDB site
Description: n-terminal egf-like domain from human factor vii, nmr, 23 structures
Class: blood coagulation
Keywords: blood coagulation, egf, hydrolase, serine protease
Deposited on 1998-05-28, released 1999-02-16
The last revision prior to the SCOP 1.75 freeze date was dated 1999-02-16, with a file datestamp of 2007-06-04.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: factor vii
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08709 (0-40)
  Domains in SCOP 1.75: d1bf9a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bf9A (A:)
  sdgdqcasspcqnggsckdqlqsyicfclpafegrncethk