PDB entry 1bf9

View 1bf9 on RCSB PDB site
Description: n-terminal egf-like domain from human factor vii, nmr, 23 structures
Deposited on 1998-05-28, released 1999-02-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1bf9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf9_ (-)
    sdgdqcasspcqnggsckdqlqsyicfclpafegrncethk