PDB entry 1bey

View 1bey on RCSB PDB site
Description: antibody to campath-1h humanized fab
Deposited on 1998-05-18, released 1999-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.214
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1beyH (H:)
    qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
    eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
    sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
    sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1beyH (H:)
    qvqlqesgpglvrpsqtlsltctvsgftftdfymnwvrqppgrglewigfirdkakgytt
    eynpsvkgrvtmlvdtsknqfslrlssvtaadtavyycareghtaapfdywgqgslvtvs
    sastkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1beyL (L:)
    diqmtqspsslsasvgdrvtitckasqnidkylnwyqqkpgkapklliyntnnlqtgvps
    rfsgsgsgtdftftisslqpediatyyclqhisrprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec