PDB entry 1bed

View 1bed on RCSB PDB site
Description: structure of disulfide oxidoreductase
Deposited on 1996-09-16, released 1997-10-08
The last revision prior to the SCOP 1.65 freeze date was dated 1997-10-08, with a file datestamp of 1997-10-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bed_ (-)
    aqfkegehyqvlktpassspvvseffsfycphcntfepiiaqlkqqlpegakfqknhvsf
    mggnmgqamskayatmialevedkmvpvmfnrihtlrkppkdeqelrqifldegidaakf
    daayngfavdsmvrrfdkqfqdsgltgvpavvvnnrylvqgqsvksldeyfdlvnylltl
    k