PDB entry 1bec

View 1bec on RCSB PDB site
Description: beta chain of a t cell antigen receptor
Deposited on 1995-02-28, released 1995-10-25
The last revision prior to the SCOP 1.57 freeze date was dated 1995-10-25, with a file datestamp of 1995-10-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bec_ (-)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgrad