PDB entry 1be7

View 1be7 on RCSB PDB site
Description: clostridium pasteurianum rubredoxin c42s mutant
Class: electron transport
Keywords: electron transport, metalloprotein, iron sulfur, electron transfer
Deposited on 1998-05-20, released 1998-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Gene: CLORUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00268 (0-53)
      • engineered (41)
    Domains in SCOPe 2.07: d1be7a_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be7A (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplsgvgkdqfeevee