PDB entry 1be3

View 1be3 on RCSB PDB site
Description: cytochrome bc1 complex from bovine
Deposited on 1998-05-19, released 1999-01-13
The last revision prior to the SCOP 1.61 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.26
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3A (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3B (B:)
    pqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkga
    ssfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaal
    qpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhft
    sarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvhaalvae
    saaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsg
    lfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfld
    evgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3C (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3D (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3E (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3F (F:)
    avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
    aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3G (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3H (H:)
    dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
    nslk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3J (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1be3K (K:)
    rnwvptaqlwgavgavglvsat