PDB entry 1bdq

View 1bdq on RCSB PDB site
Description: hiv-1 (2:31-37, 47, 82) protease complexed with inhibitor sb203386
Class: hydrolase
Keywords: hydrolase, aids, polyprotein, aspartyl protease, acid protease, hydroxyethylene isostere inhibitor, substrate analogue inhibitor
Deposited on 1998-05-10, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (30-36)
      • engineered (46)
      • engineered (81)
    Domains in SCOPe 2.07: d1bdqa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (30-36)
      • engineered (46)
      • engineered (81)
    Domains in SCOPe 2.07: d1bdqb_
  • Heterogens: IM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdqA (A:)
    pqitlwqrplvtikiggqlkealldtgaddsivagielpgrwkpkmvggiggfikvrqyd
    qilieicghkaigtvlvgptpiniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdqB (B:)
    pqitlwqrplvtikiggqlkealldtgaddsivagielpgrwkpkmvggiggfikvrqyd
    qilieicghkaigtvlvgptpiniigrnlltqigctlnf