PDB entry 1bdm

View 1bdm on RCSB PDB site
Description: the structure at 1.8 angstroms resolution of a single site mutant (t189i) of malate dehydrogenase from thermus flavus with increased enzymatic activity
Class: oxidoreductase(nad(a)-choh(d))
Keywords: oxidoreductase(nad(a)-choh(d))
Deposited on 1993-02-16, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • conflict (74)
      • conflict (189)
    Domains in SCOPe 2.07: d1bdma1, d1bdma2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10584 (0-326)
      • conflict (74)
      • conflict (189)
    Domains in SCOPe 2.07: d1bdmb1, d1bdmb2
  • Heterogens: NAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdmA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhssimfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdmA (A:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprlqvngkifteqgralaevakkdvkvlvv
    gnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirrmtvwgnhss
    imfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaasaanaaiehi
    rdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvvegleinefarkrmei
    taqelldemeqvkalgli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdmB (B:)
    mkapvrvavtgaagqigysllfriaagemlgkdqpvilqlleipqamkalegvvmeledc
    afpllagleatddpdvafkdadyallvgaaprkagmerrdllqvngkifteqgralaeva
    kkdvkvlvvgnpantnaliayknapglnprnftamtrldhnrakaqlakktgtgvdrirr
    mtvwgnhssimfpdlfhaevdgrpalelvdmewyekvfiptvaqrgaaiiqargassaas
    aanaaiehirdwalgtpegdwvsmavpsqgeygipegivysfpvtakdgayrvveglein
    efarkrmeitaqelldemeqvkalgli