PDB entry 1bdl

View 1bdl on RCSB PDB site
Description: hiv-1 (2:31-37) protease complexed with inhibitor sb203386
Deposited on 1998-05-10, released 1998-08-12
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bdla_
  • Chain 'B':
    Domains in SCOP 1.55: d1bdlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdlA (A:)
    pqitlwqrplvtikiggqlkealldtgaddsivagielpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bdlB (B:)
    pqitlwqrplvtikiggqlkealldtgaddsivagielpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf