PDB entry 1bdh

View 1bdh on RCSB PDB site
Description: purine repressor mutant-hypoxanthine-palindromic operator complex
Class: transcription/DNA
Keywords: transcription regulation, DNA-binding, repressor, purine biosynthesis, complex (DNA-binding protein/DNA), transcription/DNA complex
Deposited on 1996-07-25, released 1997-04-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.168
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7
      • engineered (53)
    Domains in SCOPe 2.06: d1bdha1, d1bdha2
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t )-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bdhA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bdhA (A:)
    tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslavnhtksi
    gllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvm
    cseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghreig
    vipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpta
    vfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetaf
    nmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'B':
    No sequence available.