PDB entry 1bd0

View 1bd0 on RCSB PDB site
Description: alanine racemase complexed with alanine phosphonate
Deposited on 1998-05-12, released 1998-10-14
The last revision prior to the SCOP 1.61 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.24
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bd0A (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaig
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bd0B (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnai