PDB entry 1bcp

View 1bcp on RCSB PDB site
Description: binary complex of pertussis toxin and atp
Deposited on 1995-11-21, released 1997-06-05
The last revision prior to the SCOP 1.57 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bcpA (A:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bcpA (A:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpB (B:)
    pgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgty
    lggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlcav
    fvrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatfe
    tyaltgisicnpgsslc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpC (C:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpD (D:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpE (E:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpF (F:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bcpG (G:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bcpG (G:)
    dppatvyrydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
    vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
    alatyqseylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
    rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpH (H:)
    pgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgty
    lggeyggvikdgtpggafdlkttfcimttrntgqpatdhyysnvtatrllsstnsrlcav
    fvrsgqpvigactspydgkywsmysrlrkmlyliyvagisvrvhvskeeqyydyedatfe
    tyaltgisicnpgsslc
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpI (I:)
    givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgtyl
    gqayggiikdappgagfiyretfcittiyktgqpaadhyyskvtatrllastnsrlcavf
    vrdgqsvigacaspyegryrdmydalrrllymiymsglavrvhvskeeqyydyedatfqt
    yaltgislcnpaasic
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpJ (J:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpK (K:)
    dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg
    sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcpL (L:)
    lpthlyknftvqelalklkgknqefcltafmsgrslvraclsdaghehdtwfdtmlgfai
    sayalksrialtvedspypgtpgdllelqicplngyce