PDB entry 1bcc

View 1bcc on RCSB PDB site
Description: cytochrome bc1 complex from chicken
Deposited on 1998-03-23, released 1998-08-19
The last revision prior to the SCOP 1.55 freeze date was dated 1998-08-19, with a file datestamp of 1998-08-19.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.27
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccA (A:)
    yaqalqsvpetqvsqldngvrvaseqssqptctvgvwidagsryeseknngagyflehla
    fkgtknrpqnalekevesmgahlnayssrehtayyikalskdvpkavelladivqncsle
    dsqiekerdvivrelqendtsmrevvfnylhatafqgtglaqsvegpsenirklsradlt
    eylsthytaprmvlaaaggvehqqllelaqkhfggvpftydddavptlskcrftgsqirh
    redglplahvaiavegpgwahpdlvalqvanaiighydrtyggglhsssplasiavtnkl
    cqsfqtfsicysetglfgfyfvcdrmsiddmmfvlqgqwmrlctsisesevlrgknflrn
    alvshldgttpvcedigrelltygrripleeweerlaevdarmvrevcskyiydqcpava
    gpgpieqlpdynrirsgmfwlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrglnatsslyqavakgvhqpfdvsafnasys
    dsglfgfytisqaayagqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvesseg
    fleevgsqalaagsynppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvd
    el
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bccB (B:)
    pphpqdleitklpnglviaslenyspgstigvfikagsryenssnlgtshllrlassltt
    kgassfkitrgieavggklsvestrenmaytveclrddveilmefllnvttapefrpwev
    adlqpqlkidkavafqnpqthvienlhaaayrnaladslycpdyrigkvtsvelhdfvqn
    hftsarmalvglgvshpvlknvaeqllnirgglglsgakakyrggeireqngdslvhaai
    vaesaaiggaeanafsvlqhvlganphvkrgnpfdvsafnasysdsglfgfytisqaaya
    gqvikaaynqvktiaqgnvsnenvqaaknklkakylmsvessegfleevgsqalaagsyn
    ppstvlqqidavadadvikaakkfvsrqksmaasgnlghtpfvdel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccC (C:)
    apnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadts
    lafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvill
    ltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrffa
    lhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpfl
    tlalfspnllgdpenftpanplvtpphikpewyflfayailrsipnklggvlalaasvli
    lflipflhkskqrtmtfrplsqtlfwllvanlliltwigsqpvehpfiiigqmaslsyft
    illilfptigtlenkmlny
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccD (D:)
    sdlelhppsypwshrgplssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvsvreglyfnpyfpgqaigmappiyndvlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmgllvplvyymkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccE (E:)
    shtdikvpnfsdyrrppddystkssresdpsrkgfsylvtavttlgvayaaknvvtqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccF (F:)
    srwlegirkwyynaagfnkyglmrddtiyenddvkeairrlpenlyddrmfrikraldln
    mrqqilpkeqwtkyeedvpylepylkevirerkereewdk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccG (G:)
    rqfghltrvrhlityslspfeqrpfphyfskgvpnvwrrlracilrvappflafyllytw
    gtqefekskrknpaayvn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelfdflhardhcvahk
    lfnslk
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bccJ (J:)
    tltarlysllfrrtstfaltivvgallferafdqgadaiyehinegklwkhikhkyenk