PDB entry 1bby

View 1bby on RCSB PDB site
Description: dna-binding domain from human rap30, nmr, minimized average
Deposited on 1998-04-26, released 1998-11-25
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1bby__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bby_ (-)
  raradkqhvldmlfsafekhqyynlkdlvditkqpvvylkeilkeigvqnvkgihkntwe
  lkpeyrhyq