PDB entry 1bbj

View 1bbj on RCSB PDB site
Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells
Deposited on 1992-04-30, released 1994-01-31
The last revision prior to the SCOP 1.65 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3.1 Å
R-factor: 0.176
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjH (H:)
    evqlqqsdaelvkpgasvkisckasgytftdhaihwakqkpeqglewigyispgnddiky
    nekfkgkatltadkssstaymqlnsltsedsavyfckrsyyghwgqgttltvssastkgp
    svfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtktytcnvdhkpsntkvdkrv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbjL (L:)
    diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
    rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikradaaptvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr