PDB entry 1bb7

View 1bb7 on RCSB PDB site
Description: lysozyme complex with 4-methyl-umbelliferyl chitobiose
Deposited on 1998-04-29, released 1999-05-04
The last revision prior to the SCOP 1.63 freeze date was dated 1999-05-04, with a file datestamp of 1999-05-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.175
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1bb7__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb7_ (-)
    kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
    rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
    rsyvagcgv