PDB entry 1bb6

View 1bb6 on RCSB PDB site
Description: lysozyme complex with 4-methyl-umbelliferyl chitotriose
Class: hydrolase
Keywords: hydrolase, n-acetyl-muramidase, umbelliferone glycosides
Deposited on 1998-04-29, released 1999-05-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Oncorhynchus mykiss [TaxId:8022]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11941 (0-128)
      • conflict (85)
    Domains in SCOPe 2.02: d1bb6a_
  • Heterogens: UMG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb6A (A:)
    kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
    rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
    rsyvagcgv