PDB entry 1bb4

View 1bb4 on RCSB PDB site
Description: human lysozyme double mutant a96l, w109h
Deposited on 1998-04-28, released 1998-08-12
The last revision prior to the SCOP 1.57 freeze date was dated 1998-08-12, with a file datestamp of 1998-08-12.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.249
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bb4a_
  • Chain 'B':
    Domains in SCOP 1.57: d1bb4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb4A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirahvawrnrcqnrd
    vrqyvqgcgv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bb4B (B:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavaclkrvvrdpqgirahvawrnrcqnrd
    vrqyvqgcgv