PDB entry 1bay

View 1bay on RCSB PDB site
Description: glutathione s-transferase yfyf cys 47-carboxymethylated class pi, free enzyme
Deposited on 1996-11-02, released 1997-11-12
The last revision prior to the SCOP 1.61 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bayA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqglkptclygqlpkfedgdlt
    lyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvka
    lpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayva
    rlsarpkikaflsspehvnrpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bayA (A:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtqlpkfedgdltlyqsnailrhlgrsl
    glygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqn
    qggkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflssp
    ehvnrpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bayB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqglkptclygqlpkfedgdlt
    lyqsnailrhlgrslglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvka
    lpghlkpfetllsqnqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayva
    rlsarpkikaflsspehvnrpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bayB (B:)
    ppytivyfpvrgrceamrmlladqgqswkeevvtiqlpkfedgdltlyqsnailrhlgrs
    lglygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsq
    nqggkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflss
    pehvnrpingngkq